DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG17571

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:231 Identity:84/231 - (36%)
Similarity:121/231 - (52%) Gaps:17/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLR-RRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLL 90
            |||.|.......:|:|:|:: .:|||.||||:|..:.|:|||||::.    ..|:||:::.||..
  Fly    30 RIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQS----YAASELQVRVGSTS 90

  Fly    91 LSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWG 153
            .||||..|.|.....|..|||.  .:|||:::|.:.:...|.|.||:||..:..:.....:||||
  Fly    91 RSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWG 155

  Fly   154 A---ISQRGPISNSLLYVQVKALSRESC-QKTY---LRQLPETTMCLLHPKDKGACYGDSGGPAT 211
            .   :....|  ::|..|:|..|..:.| ..||   ...:.||.:|....| |.||.||||||..
  Fly   156 TTCFLFCSSP--DTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEK-KDACQGDSGGPLV 217

  Fly   212 YQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247
            ...||||:.|:..|......|..|..|:.||:||.:
  Fly   218 ADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWIVD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 82/227 (36%)
Tryp_SPc 28..248 CDD:238113 83/230 (36%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 82/227 (36%)
Tryp_SPc 31..254 CDD:238113 83/230 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.