DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and SPH93

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:248 Identity:70/248 - (28%)
Similarity:112/248 - (45%) Gaps:45/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSG--- 94
            :||..|:|..:::...|.:..|||:|..:.|:|.||.|     :....||.::||...|.|.   
  Fly   251 QARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRV-----ITIETELVVRAGDWDLKSDREI 310

  Fly    95 --GVRVPVATVTVHP--NYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDA----TVDISG 151
              ..:..|....:|.  ::.|..:::|:|.|.:....|.:|..|.|.|   ||.:    ...::|
  Fly   311 FLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPT---PNKSFAGRRCTVAG 372

  Fly   152 WGAI---SQRGPISNSLLYVQVKALSRESCQKTYLR--------QLPETTMCLLHPKDKGACYGD 205
            ||.:   .||  .|..|..||:..::|..|:| :||        :||:..:|......:..|.||
  Fly   373 WGKMRYEDQR--YSTVLKKVQLLVVNRNVCEK-FLRSTRLGAKFELPKNIICAGGELGRDTCTGD 434

  Fly   206 SGGPATYQG---------KLVGLASFVIGGCGR-AAPDGYERVSKLRNWIAEK 248
             ||.|.:..         :..|:.::.: |||: ..|..|..|||..|||.||
  Fly   435 -GGSALFCSIGGENSGVYEQAGIVNWGV-GCGQEGIPAIYTEVSKFTNWITEK 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 66/243 (27%)
Tryp_SPc 28..248 CDD:238113 68/246 (28%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 68/246 (28%)
Tryp_SPc 252..482 CDD:214473 66/242 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457617
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.