DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Send2

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:247 Identity:86/247 - (34%)
Similarity:119/247 - (48%) Gaps:28/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWTSLLVLCAAGVLAQNDSVVEP--RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTA 66
            |..|.|:|.|...|:.. .|:.|  ||:||......:.|.|:|::|.|.|.|||||.|.|.::||
  Fly     2 FIQSFLLLLALNSLSAG-PVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITA 65

  Fly    67 AHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNI 131
            |||| ||..      .:::|||.|.:|.|..|.||.:..|...   |:|:|::||...|.|.:.:
  Fly    66 AHCV-QGQG------YQVRAGSALKNSNGSVVDVAAIRTHEGL---GNDIAIVRLSKPLEFTNQV 120

  Fly   132 AAIKLATEDPPNDATVDISGWGAISQRG-PI--SNSLLYVQVKALSRESCQKTYLRQLPETTMCL 193
            ..|.||..:||..:...:||||:.|... ||  ....||:          |..|...|.|.:...
  Fly   121 QPIPLAKTNPPPGSIAFVSGWGSSSYYSHPIDLQGVNLYI----------QWPYYCGLTEPSRIC 175

  Fly   194 LHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            .....:.||.||||||..:..:|||:.|.....|..::.  |..|...|.||
  Fly   176 AGSFGRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSSI--YTSVPYFREWI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 76/220 (35%)
Tryp_SPc 28..248 CDD:238113 77/221 (35%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 76/220 (35%)
Tryp_SPc 27..225 CDD:238113 75/219 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.