DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG5390

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:271 Identity:80/271 - (29%)
Similarity:119/271 - (43%) Gaps:50/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QNDSVVEPRIVGGT--KAREGQFPHQIS-LRRRGS---HTCGGSIISKDYVVTAAHCV--KQGNN 75
            ||.:.|..:|.|..  :|..|:||..:: ||..|:   :.|||::|:.:.|:||||||  ||.::
  Fly   138 QNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSS 202

  Fly    76 -VAPANELEIQAGSLLLSSGGVRVP----VATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAA 133
             |..|.|.:.|      :...:|..    |..:..|..:|...  :||||:.|.:..|...||..
  Fly   203 IVVRAGEWDTQ------TQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQT 261

  Fly   134 IKLATEDPPND-----ATVDISGWG--AISQRGPISNSLLYVQVKALSRESCQKTYLRQ------ 185
            :.|.......|     ||    |||  ...:.|.....|..|.:..:..:.|: |.||:      
  Fly   262 VCLPNVGDKFDFDRCYAT----GWGKNKFGKDGEYQVILKKVDMPVVPEQQCE-TNLRETRLGRH 321

  Fly   186 --LPETTMCLLHPKDKGACYGDSGGPAT-------YQGKLVGLASFVIGGCGRA-APDGYERVSK 240
              |.::.:|....|||..|.||.|.|..       .:.|..|:.::.| |||.. .|..|..|:|
  Fly   322 FILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGI-GCGEVNIPGVYASVAK 385

  Fly   241 LRNWIAEKASL 251
            ||.||..|..:
  Fly   386 LRPWIDAKLKI 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 74/255 (29%)
Tryp_SPc 28..248 CDD:238113 76/257 (30%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 73/249 (29%)
Tryp_SPc 153..390 CDD:214473 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.