DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Try29F

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:261 Identity:86/261 - (32%)
Similarity:130/261 - (49%) Gaps:22/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQNDSV--------VEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYV 63
            ::|.|...|:|..|.|:        ::.|||||..|.....|:|:|| :|..|.||||:|::.:|
  Fly    13 TILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSL-QRSYHFCGGSLIAQGWV 76

  Fly    64 VTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLT 126
            :|||||. :|:.:..:   :::.||...|.||..|.:..|..||.:::.  ..|.::|.|.....
  Fly    77 LTAAHCT-EGSAILLS---KVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSA 137

  Fly   127 FNSNIAAIKLATEDPP-NDAT-VDISGWGAISQRGPISNSLLYVQVKALSRESCQKTY--LRQLP 187
            .|...|.:.|..:|.. .|.| |.:||||........|..|..|.|..:|:..|.:.|  ...:.
  Fly   138 KNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSIT 202

  Fly   188 ETTMCLLHPK-DKGACYGDSGGPATYQGKLVGLASFVIGGCGRA-APDGYERVSKLRNWIAEKAS 250
            :..:|...|: .|.||.||||||....|.|.|:.|:.. ||.|. .|..|.|||.:|:||:..:.
  Fly   203 DRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGY-GCARPNYPGVYSRVSAVRDWISSVSG 266

  Fly   251 L 251
            :
  Fly   267 I 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 78/225 (35%)
Tryp_SPc 28..248 CDD:238113 79/227 (35%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 78/225 (35%)
Tryp_SPc 42..264 CDD:238113 79/227 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.