DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and TMPRSS11A

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_872412.3 Gene:TMPRSS11A / 339967 HGNCID:27954 Length:421 Species:Homo sapiens


Alignment Length:257 Identity:77/257 - (29%)
Similarity:123/257 - (47%) Gaps:30/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNV 76
            |...|:..|.:    ||..|..|.:..:|.|.||:....|.||.::||..::||||||.::..| 
Human   178 CGKRVVPLNVN----RIASGVIAPKAAWPWQASLQYDNIHQCGATLISNTWLVTAAHCFQKYKN- 237

  Fly    77 APANELEIQAGSLL---LSSGGVRVPVATVTVHPNYNS--NGHDVAVLRLRNSLTFNSNIAAIKL 136
              .::..:..|:.:   |....||    ...:|..|.|  ..:|:||:::.:.:||:.:|..|.|
Human   238 --PHQWTVSFGTKINPPLMKRNVR----RFIIHEKYRSAAREYDIAVVQVSSRVTFSDDIRQICL 296

  Fly   137 ---ATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQ--KTYLRQLPETTMCLLHP 196
               :....|| .||.|:|:||:...|...|.|...:||.:|.:.|:  :.|...:.....|..:.
Human   297 PEASASFQPN-LTVHITGFGALYYGGESQNDLREARVKIISDDVCKQPQVYGNDIKPGMFCAGYM 360

  Fly   197 KD-KGACYGDSGGPATYQG-----KLVGLASFVIGGCG-RAAPDGYERVSKLRNWIAEKASL 251
            :. ..||.||||||...:.     .|:|:.|:. ..|| :..|..|.:|:..|||||.|..:
Human   361 EGIYDACRGDSGGPLVTRDLKDTWYLIGIVSWG-DNCGQKDKPGVYTQVTYYRNWIASKTGI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 70/234 (30%)
Tryp_SPc 28..248 CDD:238113 72/236 (31%)
TMPRSS11ANP_872412.3 SEA 49..147 CDD:279699
Tryp_SPc 189..415 CDD:214473 70/234 (30%)
Tryp_SPc 190..418 CDD:238113 72/236 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.