DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and PRSS38

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:253 Identity:72/253 - (28%)
Similarity:121/253 - (47%) Gaps:21/253 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPA 79
            |.:|.....:|.:|:||..|.|.::|.|:|:...|.|.|||||:::.:|::||||..:..|:   
Human    47 GSVACGRPSMEGKILGGVPAPERKWPWQVSVHYAGLHVCGGSILNEYWVLSAAHCFHRDKNI--- 108

  Fly    80 NELEIQAGSLLLSSGGVRV---PVATVTVHPN---YNSNGHDVAVLRLRNSLTFNSNIAAIKLAT 138
            ...::..|.:.|...|...   .|..|.:||.   |:..|.|||:::|:..:.|:.::..:.|||
Human   109 KIYDMYVGLVNLRVAGNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLPVCLAT 173

  Fly   139 -EDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTY--LRQLPETTMC---LLHPK 197
             |.....|....:|||.:|::|..|:.|..:|:..:....|...|  :..:....:|   :|:.|
Human   174 PEVNLTSANCWATGWGLVSKQGETSDELQEMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAK 238

  Fly   198 DKGACYGDSGGPATYQGK----LVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKASL 251
            .  .|.||||||...:..    .:|:.|:..|......|..|..||....||.:...:
Human   239 T--VCEGDSGGPLVCEFNRSWLQIGIVSWGRGCSNPLYPGVYASVSYFSKWICDNIEI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/233 (29%)
Tryp_SPc 28..248 CDD:238113 69/235 (29%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.