DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and PRSS53

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:322 Identity:81/322 - (25%)
Similarity:124/322 - (38%) Gaps:92/322 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTSLLVLCAAGVLAQNDSVVE----PRIVGGTKARE-----GQFPHQISLRRRGSHTCGGSIISK 60
            |..:|::..|.||.:.....:    .|..|..|.:|     |::|.|.|:||:|:|.|.||:::.
Human     5 WGPVLLIAGATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPGEWPWQASVRRQGAHICSGSLVAD 69

  Fly    61 DYVVTAAHCVKQGNNVAPANEL---EIQAGSLL---LSSGGVRVPVATVTVHPNYN--SNGHDVA 117
            .:|:|||||.::    |.|.||   .:..|||.   ||.|...|.||.:.:...||  |.|.|:|
Human    70 TWVLTAAHCFEK----AAATELNSWSVVLGSLQREGLSPGAEEVGVAALQLPRAYNHYSQGSDLA 130

  Fly   118 VLRLRNSLTFNSNIAAIKLATEDP----PNDATVDISGWGAISQRG------------------- 159
            :|:|.:..|..      .|....|    |..|:...:||...:..|                   
Human   131 LLQLAHPTTHT------PLCLPQPAHRFPFGASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTV 189

  Fly   160 --------------------------PISNSLLYVQVKALSRESCQKTYLRQLPETTMC------ 192
                                      |...:|..::::.:||.:|...| .||.:..:.      
Human   190 SAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIY-NQLHQRHLSNPARPG 253

  Fly   193 LL----HPKDKGACYGDSGGPATY---QGKLV--GLASFVIGGCGRAAPDGYERVSKLRNWI 245
            :|    .|..:|.|.||||||...   .|..|  |:.||........||......:...:|:
Human   254 MLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFASSCAQEDAPVLLTNTAAHSSWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 75/294 (26%)
Tryp_SPc 28..248 CDD:238113 75/295 (25%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 72/285 (25%)
Tryp_SPc 43..314 CDD:214473 71/281 (25%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.