DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG3355

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:237 Identity:88/237 - (37%)
Similarity:123/237 - (51%) Gaps:17/237 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSH----TCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG 87
            |||||.:.|..::|....| .:|.|    .||||:|:..||:||||||....:......|:|...
  Fly    75 RIVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRS 138

  Fly    88 SLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKLATEDPPNDA-TVDI 149
            |  ...|.||..|.| ||||||:.|.  :|||:|:|.:.:....|:..:.|...:...|. |..:
  Fly   139 S--RDPGIVRKVVQT-TVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVV 200

  Fly   150 SGWGAISQRGPISNSLLYVQVKALSRESCQKT-YLRQLPETTMC--LLHPKDKGACYGDSGGP-A 210
            :|||.|.:.|..||.|..|.|..::...|::| |..::.|..:|  |:....|.||.|||||| .
  Fly   201 AGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLI 265

  Fly   211 TYQG--KLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKAS 250
            ..:|  ||.|:.||..|...:.||..|.||||..:||.:..:
  Fly   266 VNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 86/230 (37%)
Tryp_SPc 28..248 CDD:238113 87/232 (38%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 86/230 (37%)
Tryp_SPc 76..305 CDD:238113 87/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457770
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.