DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG31954

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:275 Identity:89/275 - (32%)
Similarity:134/275 - (48%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQ--------NDSVVEP---------RIVGGTKAREGQFPHQISLRRRGSHTCG 54
            |||||....::.|        .|.:..|         |||||.:......|||:|| :..||.||
  Fly    13 SLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSL-QTSSHICG 76

  Fly    55 GSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHP--NYNSNGHDVA 117
            |||||:::::|||||. .|..   |:.|:::.|:...:..|..:.|..:..|.  ||.:..:|.:
  Fly    77 GSIISEEWILTAAHCT-YGKT---ADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFS 137

  Fly   118 VLRLRNSLTFNSNIAAIKLATEDPP--NDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQK 180
            :|:|.:.:.|:....|:||......  :.....:||||...........|..|:|..:::|.|.:
  Fly   138 LLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSE 202

  Fly   181 TYLRQ--LPETTMC---LLHPKDKGACYGDSGGP-ATYQGKLVGLASFVIGGCGRAAPD---GYE 236
            .|.:.  :.|..:|   |...||  ||.|||||| .:..|:|||:.|:   |.|.|.||   .|.
  Fly   203 KYKQYGGVTERMICAGFLEGGKD--ACQGDSGGPMVSESGELVGVVSW---GYGCAKPDYPGVYS 262

  Fly   237 RVSKLRNWIAEKASL 251
            |||..|:||.|.:.:
  Fly   263 RVSFARDWIKEHSGV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 78/230 (34%)
Tryp_SPc 28..248 CDD:238113 79/232 (34%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 78/230 (34%)
Tryp_SPc 51..274 CDD:238113 79/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.