DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG4271

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:225 Identity:67/225 - (29%)
Similarity:104/225 - (46%) Gaps:11/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLS 92
            |..|.:|:...:....|:...|.|.|||::|....|:|||.|||.    .|...:.::.|:..:.
  Fly    19 IYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKN----KPVKRITVRVGTPDIY 79

  Fly    93 SGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWG-AIS 156
            .||..:.|..:.||.||.:..:|:|:|.|...: .:..:..|.|||::|..:.....:||| .:.
  Fly    80 RGGRIIRVTALVVHENYKNWDNDIALLWLEKPV-LSVRVTKIPLATKEPSENEYPSNAGWGEKLL 143

  Fly   157 QRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLAS 221
            :...::..|.....|...|..|.:..:..:.|..:|..: .:...|.||.|||.....|:||:| 
  Fly   144 ESYVVTRKLQNGVTKIRPRSMCAEELVEPVGEELLCAFY-TENDICPGDYGGPLVLANKVVGIA- 206

  Fly   222 FVIG-GCGRAA-PDGYERVSKLRNWIAEKA 249
             |.| |||.|. |..|..|.....||.|.|
  Fly   207 -VQGHGCGFAVLPSLYTNVFHYLEWIEENA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 63/219 (29%)
Tryp_SPc 28..248 CDD:238113 65/222 (29%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 65/222 (29%)
Tryp_SPc 19..231 CDD:214473 63/219 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.