DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Send1

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:233 Identity:90/233 - (38%)
Similarity:125/233 - (53%) Gaps:26/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VVEP--RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQ 85
            ::||  ||:||:.......|.|:||:..|.|.|||||.||..::|||||:|:|       |..|:
  Fly    23 LLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKEG-------ERSIR 80

  Fly    86 AGSLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVD 148
            |||.|..||||.|.|....:||.::.:.  :|||||:|.:.|:|:.:|..|.||..|||..::..
  Fly    81 AGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSAL 145

  Fly   149 ISGWGAISQRGPISNSLLYVQ----VKALSRE--SCQKTYLRQLPETTMCLLHPKDKGACYGDSG 207
            .:|||    ||   |.|:..:    |:.|.|.  .|:..|...:....:| .....||.||||||
  Fly   146 ATGWG----RG---NFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDIC-AGRMGKGGCYGDSG 202

  Fly   208 GPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            ||..:.|:|||:.|.. |.........|..|::.||||
  Fly   203 GPLVFNGQLVGITSRT-GNIVCLGSSLYASVARYRNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 86/225 (38%)
Tryp_SPc 28..248 CDD:238113 87/226 (38%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 86/225 (38%)
Tryp_SPc 30..239 CDD:238113 85/224 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.