DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Ser6

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:230 Identity:106/230 - (46%)
Similarity:143/230 - (62%) Gaps:6/230 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQ---GNNVAP--ANELEIQA 86
            |:|||..|.:.|||||:|||..|||:|||||:::.|::||||||..   .:.:.|  |....|:|
  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRA 95

  Fly    87 GSLLLSSGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISG 151
            ||....||||.|.||.|.||..|.:..:|||:|||.:.|..:::|..|.|.|.|.|.|..|.|||
  Fly    96 GSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILSASIQPIDLPTVDTPADVDVVISG 160

  Fly   152 WGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGACYGDSGGPATYQGKL 216
            ||.|..:|.:...|.|..:|:::|:.|::...... |..:||||..|.|||.|||||||.|..:|
  Fly   161 WGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFGF-EGELCLLHQVDNGACNGDSGGPAVYNNQL 224

  Fly   217 VGLASFVIGGCGRAAPDGYERVSKLRNWIAEKASL 251
            ||:|.||:.|||...||||.||...::||.:.:.:
  Fly   225 VGVAGFVVDGCGSTYPDGYARVFYFKDWIKKHSDV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 104/222 (47%)
Tryp_SPc 28..248 CDD:238113 105/224 (47%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 104/222 (47%)
Tryp_SPc 32..256 CDD:238113 105/224 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473226
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 1 1.000 - - H114140
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D121264at33392
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 1 1.000 - - otm47449
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.