DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP008997

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_319746.4 Gene:AgaP_AGAP008997 / 3291872 VectorBaseID:AGAP008997 Length:248 Species:Anopheles gambiae


Alignment Length:248 Identity:76/248 - (30%)
Similarity:119/248 - (47%) Gaps:43/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHT----CGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG 87
            |||||..:..|..|.|.:|.:.|..|    |||::||..:||||||||        |..|:::.|
Mosquito     7 RIVGGHSSGFGTHPWQAALIKSGFLTKKLSCGGALISNRWVVTAAHCV--------ATNLKVRLG 63

  Fly    88 SLLLSSGGVRV-----PVATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKLATEDPPNDA 145
            ...:.....|:     .:....|||||:.:.  :|:|:::|...:.|..:|..:.|    ||...
Mosquito    64 EWDVRDQEERLTHEEYSIERKEVHPNYSPSDFRNDIALVKLDRKVVFRQHILPVCL----PPKSV 124

  Fly   146 TV-----DISGWGAISQ-RGPISNSLLYVQVKALSRESCQKTY-----LRQLPETTMCLLHPKDK 199
            .:     .::|||.... :..:.:.|..|.|:.:..|.||:.:     ...:.:..:|..: |:.
Mosquito   125 KLVGKMATVAGWGRTRHGQSTVPSVLQEVDVEVIPNERCQRWFRAAGRRETIHDVFLCAGY-KEG 188

  Fly   200 G--ACYGDSGGPAT--YQGK--LVGLASFVIGGCGRA-APDGYERVSKLRNWI 245
            |  :|.||||||.|  .:|:  |:||.|:.| ||||. .|..|..:.|...||
Mosquito   189 GRDSCQGDSGGPLTLSIEGRKTLIGLVSWGI-GCGREHLPGVYTNIQKFVPWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 74/246 (30%)
Tryp_SPc 28..248 CDD:238113 75/247 (30%)
AgaP_AGAP008997XP_319746.4 Tryp_SPc 7..240 CDD:214473 74/246 (30%)
Tryp_SPc 8..243 CDD:238113 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.