DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and TRY2_ANOGA

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_555167.1 Gene:TRY2_ANOGA / 3291694 VectorBaseID:AGAP008295 Length:277 Species:Anopheles gambiae


Alignment Length:266 Identity:83/266 - (31%)
Similarity:132/266 - (49%) Gaps:27/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLAQNDSVVEP----------------RIVGGTKAREGQFPHQISLRRRGSHTCGGSI 57
            :|.||....::...:|.|                |:|||.:......|:|:||:...||.||||:
Mosquito    16 VVACAQAQPSRRHHLVHPLLPRFLPRLHRDSNGHRVVGGFQIDVSDAPYQVSLQYFNSHRCGGSV 80

  Fly    58 ISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLR 120
            :...:|:|||||. ||  :.|:: |.::.||...::||..|.|.....||.|:.|  .:|.:::.
Mosquito    81 LDNKWVLTAAHCT-QG--LDPSS-LAVRLGSSEHATGGTLVGVLRTVEHPQYDGNTIDYDFSLME 141

  Fly   121 LRNSLTFNSNIAAIKLAT-EDPPNDATV-DISGWGAISQRGPISNSLLYVQVKALSRESCQKTYL 183
            |...|||:..:..::|.. |:|....|: .:||||........|:.|....|..:|.|.|...|:
Mosquito   142 LETELTFSDAVQPVELPEHEEPVEPGTMATVSGWGNTQSAVESSDFLRAANVPTVSHEDCSDAYM 206

  Fly   184 --RQLPETTMCLLHPK-DKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
              .::.:..:|..:.: .|.||.||||||....|||||:.|:..|......|..|.||:.:|:|:
Mosquito   207 WFGEITDRMLCAGYQQGGKDACQGDSGGPLVADGKLVGVVSWGYGCAQPGYPGVYGRVASVRDWV 271

  Fly   246 AEKASL 251
            .|.:.:
Mosquito   272 RENSGV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 76/224 (34%)
Tryp_SPc 28..248 CDD:238113 76/226 (34%)
TRY2_ANOGAXP_555167.1 Tryp_SPc 50..271 CDD:214473 76/224 (34%)
Tryp_SPc 51..274 CDD:238113 76/226 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.