DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and TRY3_ANOGA

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_317171.2 Gene:TRY3_ANOGA / 3291693 VectorBaseID:AGAP008294 Length:268 Species:Anopheles gambiae


Alignment Length:255 Identity:87/255 - (34%)
Similarity:136/255 - (53%) Gaps:20/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLCAAGVLAQNDSV-------VEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAA 67
            |.||...:||....       |..|||||.:....:.|:|:||:...||.||||:::..:::|||
Mosquito    17 VACAQARVAQQHRFLPRPKYDVGHRIVGGFEIDVSETPYQVSLQYFNSHRCGGSVLNSKWILTAA 81

  Fly    68 HCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSN 130
            ||..   |:.|:: |.::.||...:|||..|.||.|..||||:.:  .:|.:::.|.:.|||:..
Mosquito    82 HCTV---NLQPSS-LAVRLGSSRHASGGTVVRVARVLEHPNYDDSTIDYDFSLMELESELTFSDV 142

  Fly   131 IAAIKLATEDPP-NDATVDI-SGWGAISQRGPISNSLL-YVQVKALSRESCQKTYLRQ--LPETT 190
            :..:.|..:|.. .|.|:.| ||||. :|....||::| ...|..::::.|...|...  :.:..
Mosquito   143 VQPVSLPDQDEAVEDGTMTIVSGWGN-TQSAAESNAILRAANVPTVNQKECTIAYSSSGGITDRM 206

  Fly   191 MCLLHPK-DKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKA 249
            :|..:.: .|.||.||||||....|||||:.|:..|......|..|.||:.:|:|:.|.:
Mosquito   207 LCAGYKRGGKDACQGDSGGPLVVDGKLVGVVSWGFGCAMPGYPGVYARVAVVRDWVRENS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 79/225 (35%)
Tryp_SPc 28..248 CDD:238113 79/227 (35%)
TRY3_ANOGAXP_317171.2 Tryp_SPc 41..262 CDD:214473 79/225 (35%)
Tryp_SPc 42..265 CDD:238113 79/227 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.