DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP005665

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_556314.2 Gene:AgaP_AGAP005665 / 3290017 VectorBaseID:AGAP005665 Length:300 Species:Anopheles gambiae


Alignment Length:267 Identity:78/267 - (29%)
Similarity:121/267 - (45%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRR---GSHTCGGSIISKDYVVT 65
            :|..|    .|.:......:...|||.|.:|..||||:||:|...   |:..||||:::.:|::|
Mosquito    35 YWARL----PAELQVYRTKLPSHRIVNGQEATPGQFPYQIALLSNFPTGTGLCGGSVLTNNYILT 95

  Fly    66 AAHCVKQGNN--------VAPANELEIQAGS---LLLSSGGVRVPVATVTVHPNYNSNG--HDVA 117
            |||||..|.:        :..|:..::...|   :..|:.|:|       .||.|....  :|:|
Mosquito    96 AAHCVISGASTLALGGTAIIGAHNRDVAEPSQQRIAFSTAGIR-------AHPGYTLTNIRNDIA 153

  Fly   118 VLRLRNSLTFNSNIAAIKLATEDPPND---ATVDISGWGAISQRGPISNS-LLYVQVKALSRESC 178
            |:||.:.:||...|...:|........   .|..:||:|..|.....::| :::.....|:...|
Mosquito   154 VVRLNSPITFTDRIQPARLPARSDTRQFGGFTGTVSGFGRTSDASQATSSVVMFTTNPVLTNADC 218

  Fly   179 QKTYLRQLPE-TTMCLLHPKDKGACYGDSGGPATYQ--GKL-VGLASF-VIGGCGRAAPDGYERV 238
            ...:...:.| ..:||.....:.:|.||||||...|  |.| ||:.|| ...||....|..|.||
Mosquito   219 IAQWNAVVIEPQNVCLSGAGGRSSCNGDSGGPLAVQDGGSLQVGVVSFGSAAGCAIGMPSVYARV 283

  Fly   239 SKLRNWI 245
            |...::|
Mosquito   284 SFFLDFI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 74/242 (31%)
Tryp_SPc 28..248 CDD:238113 74/243 (30%)
AgaP_AGAP005665XP_556314.2 Tryp_SPc 54..290 CDD:214473 74/242 (31%)
Tryp_SPc 55..293 CDD:238113 74/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.