DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss34

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:247 Identity:71/247 - (28%)
Similarity:109/247 - (44%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGTKAREGQFPHQISLR------RRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQA 86
            ||||......:||.|:|||      .|..|.||||:|...:|:||||||:.  ....|..:.:|.
Mouse    35 IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVRP--KEVEAYGVRVQV 97

  Fly    87 GSLLLSSGGVRVPVATVTVHPNYNS-----NGHDVAVLRLRNSLTFNSNIAAIKL--ATEDPPND 144
            |.|.|......:.|..:..||.::.     .|.|:|:|:|...:..:.::..:.|  |:....:.
Mouse    98 GQLRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVVLSEHVYPVSLPAASLRISSK 162

  Fly   145 ATVDISGWGAISQRGPI--SNSLLYVQVKALSRESCQKTY---------LRQLPETTMCLLHPKD 198
            .|..::|||.|....|:  ...|..|.|..:....|::.|         .|.:.:..:| ...:.
Mouse   163 KTCWVAGWGVIENYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDSTTRIIKDDMLC-AGKEG 226

  Fly   199 KGACYGDSGGPATYQGKL----VGLASFVIGGCGRA-APDGYERVSKLRNWI 245
            :.:|..|||||...:...    ||:.|:.| |||.. .|..|.||....:||
Mouse   227 RDSCKADSGGPLVCRWNCSWVQVGVVSWGI-GCGLPDFPGVYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/245 (28%)
Tryp_SPc 28..248 CDD:238113 71/247 (29%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 71/247 (29%)
Tryp_SPc 35..277 CDD:214473 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.