DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Hayan

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:252 Identity:74/252 - (29%)
Similarity:114/252 - (45%) Gaps:43/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGTKAREGQFPHQ--ISLRRRGS--HTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGS 88
            |:.|.:...|.:||.  |:....||  ..||||:|:..:|:||||||...::....    ::.|:
  Fly   385 ILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSF----VRLGA 445

  Fly    89 LLLSS---GGVRVPVATVTVHPNY--NSNGHDVAVLRLRNSLTFNSNIAAIKLATE--DPPNDAT 146
            |.:.:   |...:.|..|.:||:|  :|..:|:|:|:|......:..|....|.|:  |||.:..
  Fly   446 LNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPANYK 510

  Fly   147 VDISGWGA--ISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCL--------LHPKDKG- 200
            ..::|||.  ::.|. :|..||...:..:..:.|..::..| |.....|        |...||. 
  Fly   511 YFVAGWGVMNVTNRA-VSKILLRAALDLVPADECNASFAEQ-PSANRTLRRGVIASQLCAADKNQ 573

  Fly   201 ---ACYGDSGGP---------ATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
               ||.||||||         .||  .:||:.|... ||....|..|.|||...::|
  Fly   574 RKDACQGDSGGPLILEIDDVDGTY--SIVGVISSGF-GCATKTPGLYTRVSSFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 73/250 (29%)
Tryp_SPc 28..248 CDD:238113 74/252 (29%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 73/250 (29%)
Tryp_SPc 385..630 CDD:238113 74/252 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.