DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG9673

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:257 Identity:89/257 - (34%)
Similarity:130/257 - (50%) Gaps:30/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQ- 72
            |.|...|::...::..:.||:||....:|::|...|:|...:|.|.|:|||.::::||||||.. 
  Fly    10 LGLLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSV 74

  Fly    73 GNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKL- 136
            |.....|:.|.::.|::...:||..|.|.:|.:||:|.:..||:|:|.|..:|.|:..|..|.| 
  Fly    75 GITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFLHDIAILELDETLVFSDRIQDIALP 139

  Fly   137 -----ATEDP----PNDATVDISGWGAISQRGPISNSLLYVQVKA----LSRESCQ----KTYLR 184
                 .|||.    ||...|.::|||.:|. |..|    |.|.||    |||..|:    ..|  
  Fly   140 PTTDEETEDVDAELPNGTPVYVAGWGELSD-GTAS----YKQQKANYNTLSRSLCEWEAGYGY-- 197

  Fly   185 QLPETTMCLLHPKDKGACYGDSGGPATYQGKLV-GLASFVIGGCGRAAPDGYERVSKLRNWI 245
               |:.:||...:.:|.|.||:|.......|:: ||.||..|.||...||...|||....||
  Fly   198 ---ESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 84/237 (35%)
Tryp_SPc 28..248 CDD:238113 85/238 (36%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 84/237 (35%)
Tryp_SPc 29..259 CDD:238113 85/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 1 1.000 - - otm47449
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.