DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and sphe

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:244 Identity:84/244 - (34%)
Similarity:125/244 - (51%) Gaps:5/244 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQ 72
            |::|...|:.|......:.||:||..|.........|||...:|.|||||:|:..::|.||||.:
  Fly     6 LVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHR 70

  Fly    73 GNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKLA 137
            ...:..|:.|..:.||....:||..|.|.:|.|||:|.:..:::||:.|.:.||:...|.||.|.
  Fly    71 DGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRITAIPLV 135

  Fly   138 TED---PPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDK 199
            ...   |...:.|.::|||..|. |..|..:..:.:|.....:|...| ....|.:.||.|...:
  Fly   136 ASGEALPAEGSEVIVAGWGRTSD-GTNSYKIRQISLKVAPEATCLDAY-SDHDEQSFCLAHELKE 198

  Fly   200 GACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEK 248
            |.|:||.||.|.|...|:||.:||:|.||...||.:.|:|...:||.|:
  Fly   199 GTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 77/220 (35%)
Tryp_SPc 28..248 CDD:238113 78/222 (35%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 74/206 (36%)
Tryp_SPc 42..244 CDD:214473 72/203 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 1 1.000 - - otm47449
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.