DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG31780

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster


Alignment Length:242 Identity:68/242 - (28%)
Similarity:110/242 - (45%) Gaps:40/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AREGQFPHQISL--RRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSS--- 93
            |:|.:.|..::|  .|..|:..||::|:...|:||    :|......|::|.::||....|:   
  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITA----RQRTENMTASQLVVRAGEWDFSTKTE 173

  Fly    94 --GGVRVPVATVTVHPNYN-SNG-HDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDIS---- 150
              ..|.||:.::..||.:| .|| ::||::.||.|||.:.:|..|.:    |......|.|    
  Fly   174 QLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICM----PSAPKNFDFSRCIF 234

  Fly   151 -GWGAISQRGP-ISNSLLYVQVKALSRESCQKTYLR-------QLPETTMCLLHPKDKGACYGDS 206
             |||..|...| ..|.|..:.:..:.|.:|:: .||       :|..:.||......|.:|.||.
  Fly   235 TGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQ-QLRLYYGNDFELDNSLMCAGGEPGKDSCEGDG 298

  Fly   207 GGPAT-------YQGKLVGLASFVIGGCG-RAAPDGYERVSKLRNWI 245
            |.|..       .:.:|.|:.:|.: .|| ...|..|..|:.:..||
  Fly   299 GSPLACAIKDNPQRYELAGIVNFGV-DCGLPGVPAVYTNVANVIEWI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 66/240 (28%)
Tryp_SPc 28..248 CDD:238113 68/242 (28%)
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/240 (28%)
Tryp_SPc 113..344 CDD:238113 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.