DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG31681

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:252 Identity:85/252 - (33%)
Similarity:115/252 - (45%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK 71
            |:||..|....|......|.|||||:.......|.|:|::....|.|||.|.|...::|||||: 
  Fly     8 SILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCL- 71

  Fly    72 QGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNS---NGHDVAVLRLRNSLTFNSNIAA 133
              :||. ..:|.::|||...|.||..:.|.....||.|..   |.:|:|||.|...|.....:..
  Fly    72 --SNVT-VTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKK 133

  Fly   134 IKLATEDPPNDATVDISGWGAISQRGPISNSLLY-----VQVKALSRESCQKTYLRQLPETTMCL 193
            |.||.:.|.....|..||||...:    ::|.|:     |.|..|:|..|.|.|........|..
  Fly   134 IPLAEQTPVAGTIVLTSGWGYTRE----NSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMIC 194

  Fly   194 LHPKDKGACYGDSGGP--ATYQG---KLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            ...:....|.||||||  .|.:|   :|:|:.|:. .||| ..|..||.::...|||
  Fly   195 ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWG-DGCG-TNPGVYEDIAFFHNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 77/230 (33%)
Tryp_SPc 28..248 CDD:238113 78/231 (34%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 77/230 (33%)
Tryp_SPc 29..250 CDD:238113 78/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.