DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG31267

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:232 Identity:71/232 - (30%)
Similarity:114/232 - (49%) Gaps:23/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRR-GSHTCGGSIISKDYVVTAAHCVK--QGNNVAPANELEIQAGS 88
            |||||.::.....|:.:||:.. |:|.|.||||...:|:|||.|:.  :.|||..........| 
  Fly    44 RIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWG- 107

  Fly    89 LLLSSGGVRVPVATVTVHPNYNS--NGHDVAVLRLR-----NSLTFNSNIAAIKLATEDPPNDAT 146
                |.|....|..:.:|.|::|  ..:|:|:::..     :.:|.|..||.:    ||..:..|
  Fly   108 ----SEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPL----EDLTDGET 164

  Fly   147 VDISGWGAISQRGPISNSLLYVQVKALSRESCQKTY--LRQLPETTMCLLHPKDKGACYGDSGGP 209
            :.:.|:|:....|..|..|..:.|..::.|.|..||  ...|....:|.:.....|||:||:|||
  Fly   165 LTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCAVGKVGAGACHGDTGGP 229

  Fly   210 -ATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
             ...:|:|||:.::.: .||...||.:.|:|...:||
  Fly   230 IVDSRGRLVGVGNWGV-PCGYGFPDVFARISFYYSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/230 (30%)
Tryp_SPc 28..248 CDD:238113 70/231 (30%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 69/230 (30%)
Tryp_SPc 45..268 CDD:238113 70/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.