DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG31205

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:260 Identity:68/260 - (26%)
Similarity:109/260 - (41%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NDSVV-EP-------RIVGGTKAREGQFPHQISLRRRGSHT--CGGSIISKDYVVTAAHCVKQGN 74
            :|::: ||       ||||.||              .||:|  |.|.:|....||||||||.:  
  Fly    39 SDNIIAEPTEHPWVVRIVGVTK--------------DGSNTLLCTGILIDSRRVVTAAHCVSK-- 87

  Fly    75 NVAPANELEIQAGSLLLSSGGVRVP-VATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAIKL 136
                 :|.|...|.:...|....:. |:.|||||:|:..  .:|:|::.|...:.|:..:..|.|
  Fly    88 -----DESESIYGVVFGDSDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICL 147

  Fly   137 --ATEDPPNDATVD----ISGW-GAISQRGPISNSLLYVQVK----ALSRESCQKTYLRQLPETT 190
              .:|..|...|.:    ::|. |....|...:...|..::|    .:..:.|.:...| .||..
  Fly   148 PSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQAR-FPEEL 211

  Fly   191 MC---LLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPD--GYERVSKLRNWIAEKAS 250
            :|   ...|....|....||.|..:.  |:|:|   :.|...:..|  ||..:....:||::.:|
  Fly   212 ICGHTERSPLSGSALTEASGTPRQFH--LLGIA---VAGFFSSDLDHQGYLNIRPHLDWISKNSS 271

  Fly   251  250
              Fly   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 62/238 (26%)
Tryp_SPc 28..248 CDD:238113 63/240 (26%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 42/144 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.