DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG32834

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:267 Identity:78/267 - (29%)
Similarity:117/267 - (43%) Gaps:39/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTSLLVLCAAGVL-AQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAH 68
            |:..|.|.||.:. .:.|...:.||:||........|:|..:...|:..|.|:||:.|.::|||.
  Fly     3 WSVFLFLLAALLRPVRGDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAAS 67

  Fly    69 CVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGHD--VAVLRLRNSLTFNSNI 131
            ||:...::    |:.:...|......|..:.|..:..||.||....|  :|:|:|.:.|..:..|
  Fly    68 CVQSYGSI----EVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEAI 128

  Fly   132 AAIKLATEDPPNDATVDISGWGAIS------QR--GPISNSLLYVQVKALSRESCQK-------- 180
            ..|.:|.::|.:.:...:||||:.|      .|  |.:.:.|....|...:||.|..        
  Fly   129 QPISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVWFGL 193

  Fly   181 -----TYLRQLPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSK 240
                 :||      |:| .| ...|.|..|:|.|....|:|||:.|  .||| ...||.|..|..
  Fly   194 WDNGISYL------TLC-TH-NGAGGCSYDTGAPLVIDGQLVGILS--EGGC-TTKPDVYANVPW 247

  Fly   241 LRNWIAE 247
            ...||||
  Fly   248 FTGWIAE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 68/240 (28%)
Tryp_SPc 28..248 CDD:238113 71/243 (29%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 68/240 (28%)
Tryp_SPc 27..255 CDD:238113 71/243 (29%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.