DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG32755

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:280 Identity:87/280 - (31%)
Similarity:126/280 - (45%) Gaps:39/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTSLLVLCAAGVLAQND----------SVVEPRIVGGTKAREGQFPHQISLRRRG--------SH 51
            |..||::.....:.|:.          .|:.|:||||......|.|.|:|:|||.        .|
  Fly     5 WMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGH 69

  Fly    52 TCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGV--------RVPVATVTVHPN 108
            .|||::||:..|.:||||.....:| |....:.:...::..|..:        ...|..:..|.:
  Fly    70 VCGGAVISQRVVCSAAHCYAINTSV-PLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133

  Fly   109 YNSN--GHDVAVLRLRNSLTFNS-NIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQV 170
            ||.:  .:|:|:|.|...:.:.| .:.||.||.:.|....|..|.|||.::.:.. |.||....|
  Fly   134 YNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEK-SASLQQAPV 197

  Fly   171 KALSRESCQKTYLRQLPETTMC---LLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAP 232
            ..|::|.||..|  :||.:.||   |....|  ||.||||||....|:|.|:.|:.:|......|
  Fly   198 PILNKELCQVIY--KLPASQMCAGFLQGGID--ACQGDSGGPLICDGRLAGIISWGVGCADPGYP 258

  Fly   233 DGYERVSKLRNWIAE-KASL 251
            ..|..||....||.. .|||
  Fly   259 GVYTNVSHFLKWIRRANASL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 76/239 (32%)
Tryp_SPc 28..248 CDD:238113 78/242 (32%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 76/239 (32%)
Tryp_SPc 38..273 CDD:238113 78/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.