DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG32523

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:261 Identity:167/261 - (63%)
Similarity:206/261 - (78%) Gaps:14/261 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTS-----LLVLCAAGVL-----AQN--DSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSI 57
            ||:     ||:||...|:     |||  :|.:|||||||.||::||||||||||.||.|.|||.|
  Fly     2 WTTLWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVI 66

  Fly    58 ISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGH-DVAVLRL 121
            ||..:|:||.||||.||:|.||:...||||||||||.|||:|||.|.:||||.:.|| |:|||||
  Fly    67 ISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHNDLAVLRL 131

  Fly   122 RNSLTFNSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQL 186
            ::.|||::|||||:||||||||...|||||||.|:::||:|:|||:|||.::||.:|:..:..:|
  Fly   132 QSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRL 196

  Fly   187 PETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVI-GGCGRAAPDGYERVSKLRNWIAEKAS 250
            |||.:||||.|:.|||||||||||||.||:|||||.:: |||||||||||.|:||:|.||||||.
  Fly   197 PETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIAEKAG 261

  Fly   251 L 251
            |
  Fly   262 L 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 147/219 (67%)
Tryp_SPc 28..248 CDD:238113 149/221 (67%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 147/219 (67%)
Tryp_SPc 37..219 CDD:238113 119/181 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473218
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 1 1.000 - - H114140
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D121264at33392
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.