DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG32376

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:231 Identity:68/231 - (29%)
Similarity:105/231 - (45%) Gaps:23/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91
            |||.|.:....:.|.|.||...|...||..||:|.:::||.||.     ..|..:..::.||...
  Fly    65 RIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCF-----FGPPEKYTVRVGSDQQ 124

  Fly    92 SSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVD------ 148
            ..||....|..:.....||  :..||:|:::|::.:.|...:..:||     |:..|..      
  Fly   125 RRGGQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKL-----PSTKTTKFPKKFV 184

  Fly   149 ISGWGAISQRGP-ISNSLLYVQVKALSRESCQKTYLR---QLPETTMCLLHPKDKGACYGDSGGP 209
            :||||..|.... :...|..||:..:.|..|||.|.:   ::.:..:|... .:|.:|.||||||
  Fly   185 VSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASR-TNKDSCSGDSGGP 248

  Fly   210 ATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            .|.:|.|.|:.|:.||...:..|..|....:...||
  Fly   249 LTSRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 66/229 (29%)
Tryp_SPc 28..248 CDD:238113 67/230 (29%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 66/229 (29%)
Tryp_SPc 66..287 CDD:238113 67/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457797
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.