DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Tmprss6

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:237 Identity:81/237 - (34%)
Similarity:132/237 - (55%) Gaps:20/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91
            |||||..:.||::|.|.||:.||.|.|||::|:..:|:|||||.::.:..:| ....:..|.:..
  Rat   576 RIVGGAMSSEGEWPWQASLQIRGRHICGGALIADRWVITAAHCFQEDSMASP-RLWTVFLGKMRQ 639

  Fly    92 SS---GGVRVPVATVTVHPNYNSNGH--DVAVLRLRNSLTFNSNIAAIKLATE----DPPNDATV 147
            :|   |.|...|:.:.:||.:..:.|  |||:|:|.:.:.:::.:..:.|...    :|..... 
  Rat   640 NSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSATVRPVCLPARSHFFEPGQHCW- 703

  Fly   148 DISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPK-DKGACYGDSGGPAT 211
             |:||||..:.||.|::|..|.|:.:.::.|.:.|..|:....:|..:.| .|.||.||||||..
  Rat   704 -ITGWGAQREGGPGSSTLQKVDVQLIPQDLCNEAYRYQVTPRMLCAGYRKGKKDACQGDSGGPLV 767

  Fly   212 YQ---GK--LVGLASFVIGGCGRAAPDG-YERVSKLRNWIAE 247
            .:   |:  |.||.|:.: ||||....| |.||:::.|||.:
  Rat   768 CKEPSGRWFLAGLVSWGL-GCGRPNFFGVYTRVTRVVNWIQQ 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 79/233 (34%)
Tryp_SPc 28..248 CDD:238113 80/236 (34%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 79/233 (34%)
Tryp_SPc 577..809 CDD:238113 80/236 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.