DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG6048

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:247 Identity:75/247 - (30%)
Similarity:112/247 - (45%) Gaps:31/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRR--------GSHTCGGSIISKDYVVTAAHC-----VKQGNNVAP 78
            ||:.||:|..|...||:.:|:.        ..|.||||:|...:|:|||||     :..|..| |
  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFV-P 108

  Fly    79 ANELEIQAGSLLLSSGGVRVPVATVTVHP--------NYNSNGHDVAVLRLRNSL-TFNSNIAAI 134
            ..|..:..|:|...:   |....|.|:..        :.::...|:|:|.|..:: |.:..|..|
  Fly   109 KEEFIVVMGNLDRYN---RTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPI 170

  Fly   135 KLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESC-QKTYLRQLPETTM-C--LLH 195
            .|.....|......::|||. ::.|.:|:.|:.|.|..:|.|.| ..:.|..|.:..| |  .|.
  Fly   171 ALNRFAIPEGVVCQVTGWGN-TEDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYLE 234

  Fly   196 PKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247
            ..:|.||.||||||...|.:|.|:.|:.|.......|..|..||...:||.:
  Fly   235 VGEKDACAGDSGGPLVCQSELAGVVSWGIQCALPRLPGVYTEVSYYYDWILQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 73/243 (30%)
Tryp_SPc 28..248 CDD:238113 74/246 (30%)
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.