DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prtn3

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:260 Identity:84/260 - (32%)
Similarity:118/260 - (45%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPFWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISL---RRRGSHTCGGSIISKDYV 63
            :|....|..|..||| ..:.:|...:||||.:||....|:..||   |..|||.|||::|...:|
  Rat   173 IPRSPRLPCLRLAGV-RFHGAVQASKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFV 236

  Fly    64 VTAAHCVKQGNNVAPANELEIQ-------AGSLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVL 119
            :|||||::         ::..|       |..||.|....:....|.....|||...  :||.:|
  Rat   237 LTAAHCLQ---------DISWQLVTVVLGAHDLLSSEPEQQKFTITQVFENNYNPEETLNDVLLL 292

  Fly   120 RLRNSLTFNSNIAAIKLATEDPP-NDATVDIS-GWGAISQRGPISNSLLYVQVKALSRESCQKTY 182
            :|....:....:|...|..:|.. :..|..:: |||.:..|.|....|..:.|..:       |:
  Rat   293 QLNRPASLGKQVAVASLPQQDQSLSQGTQCLAMGWGRLGTRAPTPRVLHELNVTVV-------TF 350

  Fly   183 LRQLPETTMCLLHP-KDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAA-PDGYERVSKLRNWI 245
            |.:  |..:|.|.| :..|.|:||||||....|.|.|:.||||..|.... ||.:.|||...|||
  Rat   351 LCR--EHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWI 413

  Fly   246  245
              Rat   414  413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 75/233 (32%)
Tryp_SPc 28..248 CDD:238113 77/234 (33%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 77/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.