DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and LOC312273

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:251 Identity:79/251 - (31%)
Similarity:118/251 - (47%) Gaps:26/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAH 68
            |:| ||...||.....||.    |||||...:|...|:|:|| ..|||.||||:|:..:|::|||
  Rat     6 FFT-LLGTVAAFPTEDNDD----RIVGGYTCQEHSVPYQVSL-NAGSHICGGSLITDQWVLSAAH 64

  Fly    69 C------VKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSL 125
            |      |:.|.:    |..||:.....:.:       |.:.:||:|:  :..:|:.:::|::..
  Rat    65 CYHPQLQVRLGEH----NIYEIEGAEQFIDA-------AKMILHPDYDKWTVDNDIMLIKLKSPA 118

  Fly   126 TFNSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETT 190
            |.||.::.|.|....|.......:||||.:.......:.|..:....||...|.|.|.||:....
  Rat   119 TLNSKVSTIPLPQYCPTAGTECLVSGWGVLKFGFESPSVLQCLDAPVLSDSVCHKAYPRQITNNM 183

  Fly   191 MCL-LHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            .|| .....|.:|..|||||....|::.|:.|:..|......|..|.:|....|||
  Rat   184 FCLGFLEGGKDSCQYDSGGPVVCNGEVQGIVSWGDGCALEGKPGVYTKVCNYLNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/226 (31%)
Tryp_SPc 28..248 CDD:238113 70/227 (31%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 70/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.