DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG14780

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:267 Identity:83/267 - (31%)
Similarity:127/267 - (47%) Gaps:35/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLR------RRGS-HTCGGSIISKD 61
            ||  .|:.|||..|.:|.   :.||:.|:.|:..:..|.:|:|      ..|| |.|||::|:..
  Fly    14 FW--FLLACAAADLQENQ---QSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPR 73

  Fly    62 YVVTAAHCV--KQGNNVAPANELEIQAGSLLL---SSGGVRVPVATV----TVHPNYNSNGHDVA 117
            .|:|||||:  .|......|:|..:..|:|..   .:|.:...|:::    |..|  :|...||.
  Fly    74 KVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSP--DSMRDDVG 136

  Fly   118 VLRLRNSLTFNS------NIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRE 176
            :|.||..|..:.      .:|.|:||.:..|......::|||. :::..:||.||...|..:..:
  Fly   137 ILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGR-TEQSSLSNILLTANVSTIRHQ 200

  Fly   177 SCQKTYLRQLPETTMC---LLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERV 238
            :|:..|...|....||   |....|  :|.||||||..::|:|||:.|:..|......|..|..|
  Fly   201 TCRMIYRSGLLPGMMCAGRLQGGTD--SCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDV 263

  Fly   239 SKLRNWI 245
            ...|.||
  Fly   264 EYYRQWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 73/242 (30%)
Tryp_SPc 28..248 CDD:238113 74/243 (30%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 73/242 (30%)
Tryp_SPc 33..271 CDD:238113 74/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.