DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Ovch2

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_003749007.2 Gene:Ovch2 / 308919 RGDID:1564636 Length:579 Species:Rattus norvegicus


Alignment Length:266 Identity:79/266 - (29%)
Similarity:130/266 - (48%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SVVEP----------RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNV 76
            |:|:|          |||||::..:|.:|.|:||:::..|.|||:|||..:|:|||||:...|  
  Rat    36 SLVKPWPQNYFSLFSRIVGGSQVEKGSYPWQVSLKQKQKHICGGTIISSQWVITAAHCMANRN-- 98

  Fly    77 APANELEIQAGSLLLSS---GGVRVPVATVTVHPNYNSN---GHDVAVLRLRNSLTFNSNIAAIK 135
             .|..|.:.||...||.   |...:.:.|:.:||.:::.   .:|:|:|::..:..|...:..:.
  Rat    99 -IALTLNVTAGEHDLSQAEPGEQTLAIETIIIHPQFSTKKPMNYDIALLKMVGTFQFGQFVRPVC 162

  Fly   136 LATEDPPNDA--TVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLR-QLP---ETTMCLL 194
            |.......:|  ....:|||.:|:.|.:...|..|.:..|:.|.|:...|. :.|   :|.:|..
  Rat   163 LPEPGEQFNAGYICTTAGWGRLSEGGSLPQVLQQVNLPILTHEECEAVMLTLRNPITGKTFLCTG 227

  Fly   195 HPKDKG--ACYGDSGGPATYQGK-----LVGLASFVIGGCGRA-----------APDGYERVSKL 241
            .| |.|  ||.|||||....|.:     |.|:.|:.: ||||:           :|..:..:.::
  Rat   228 SP-DGGRDACQGDSGGSLMCQNRKGAWTLAGVTSWGL-GCGRSWRNNARKKEQGSPGIFTDLRRV 290

  Fly   242 RNWIAE 247
            ..||.|
  Rat   291 LPWIHE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 73/247 (30%)
Tryp_SPc 28..248 CDD:238113 75/250 (30%)
Ovch2XP_003749007.2 Tryp_SPc 52..297 CDD:238113 75/250 (30%)
CUB 317..420 CDD:238001
CUB 431..541 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.