DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Tmprss13

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001121000.1 Gene:Tmprss13 / 300682 RGDID:1310872 Length:539 Species:Rattus norvegicus


Alignment Length:244 Identity:70/244 - (28%)
Similarity:116/244 - (47%) Gaps:33/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHC-------VKQGNNVAPANELEI 84
            |||||....|.::|.|:||....:|.|||::|...:|:|||||       :.:|        .::
  Rat   297 RIVGGALTSESKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKILEG--------WKV 353

  Fly    85 QAGSLLLSSGGVRVPVATVTVHPNY--NSNGHDVAVLRLRNSLTFNSNI--AAIKLATEDPPNDA 145
            .||:..|........::.:.::.||  ..:.:|:|::||...||.:::|  |.:.|..:....:.
  Rat   354 YAGTSNLHQLPEAASISQIIINGNYTDEQDDYDIALVRLSKPLTLSAHIHPACLPLHGQTFGLNE 418

  Fly   146 TVDISGWGAISQRGPISNSLL-YVQVKALSRESCQK--TYLRQLPETTMC---LLHPKDKGACYG 204
            |..|:|:|...:....::..| .|||..:..:.|..  .|...|....||   |...:|  :|.|
  Rat   419 TCWITGFGKTKETDEKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDLRGGRD--SCQG 481

  Fly   205 DSGGPATYQGK----LVGLASFVIGGCG-RAAPDGYERVSKLRNWIAEK 248
            |||||...:..    |.|:.|:.. ||| :..|..|.:|:::..||..|
  Rat   482 DSGGPLVCEQNNRWYLAGVTSWGT-GCGQKNKPGVYTKVTEVLPWIYRK 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 67/239 (28%)
Tryp_SPc 28..248 CDD:238113 68/241 (28%)
Tmprss13NP_001121000.1 WWbp <1..69 CDD:304964
SRCR_2 203..292 CDD:292133
SRCR 216..288 CDD:278931
Tryp_SPc 297..526 CDD:214473 67/239 (28%)
Tryp_SPc 298..526 CDD:238113 66/238 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.