DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and GZMM

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_005308.2 Gene:GZMM / 3004 HGNCID:4712 Length:257 Species:Homo sapiens


Alignment Length:217 Identity:67/217 - (30%)
Similarity:104/217 - (47%) Gaps:25/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCV 70
            :||||| |.|.|:...| ...:|:||.:......|:..||:|.|||.|||.::...:|:|||||:
Human     6 SSLLVL-ALGALSVGSS-FGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCL 68

  Fly    71 KQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN---SNGHDVAVLRLRNSLTFNSNIA 132
            .|  .:|   :|.:..|...|.|.|:...:.....||.|.   :..:|:|:|:|...:..:..|.
Human    69 AQ--RMA---QLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIR 128

  Fly   133 AIKLATEDPPNDATV-------DISGWGAISQRGPISNSLLYVQVKALSRESCQKT--YLRQLPE 188
            .:.|     |:...|       .::|||...|.|.:|..|..:.::.|....|..:  :...|..
Human   129 PLAL-----PSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSP 188

  Fly   189 TTMCL-LHPKDKGACYGDSGGP 209
            :.:|| ...||:..|.||||||
Human   189 SMVCLAADSKDQAPCKGDSGGP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 58/196 (30%)
Tryp_SPc 28..248 CDD:238113 58/195 (30%)
GZMMNP_005308.2 Tryp_SPc 26..252 CDD:238113 58/195 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.