DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Elane

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:252 Identity:71/252 - (28%)
Similarity:120/252 - (47%) Gaps:39/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK 71
            :||::|.|         :...||||..|:...:|..:||:|||.|.||.::|::::|::||||| 
  Rat    21 ALLLVCPA---------LASEIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHCV- 75

  Fly    72 QGNNVAPANELEIQAGSLLLSSGGV--RVPVATVTVHPNYNSNG-------HDVAVLRLRNSLTF 127
            .|.|        .|:..::|.:..:  |.|...:........||       :|:.:::|..|.|.
  Rat    76 NGRN--------FQSVQVVLGAHDLRRREPTRQIFSVQRIFENGFDPSRLLNDIVIIQLNGSATI 132

  Fly   128 NSNIAAIKLATEDP--PNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETT 190
            |:|:...:|..:..  .|.......|||.:....|:.:.|..:.|..:: ..|::       ...
  Rat   133 NANVQVAELPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVVT-NLCRR-------RVN 189

  Fly   191 MCLLHP-KDKGACYGDSGGPATYQGKLVGLASFVIGGCGRA-APDGYERVSKLRNWI 245
            :|.|.| :..|.|:||||||......:.|:.||:.||||.. .||.:..|::..:||
  Rat   190 VCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGFYPDAFAPVAEFADWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 65/230 (28%)
Tryp_SPc 28..248 CDD:238113 67/231 (29%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 65/230 (28%)
Tryp_SPc 33..249 CDD:238113 67/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.