DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Klk1c3

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:263 Identity:75/263 - (28%)
Similarity:110/263 - (41%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTSLLVLCAAGVLAQNDSVV--EPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAA 67
            |  .|:|..|..|.|.|:..  :.|:|||.|..:...|.|:::  .....|||.:|...:|:|||
  Rat     2 W--FLILFLALSLGQIDAAPPGQSRVVGGFKCEKNSQPWQVAV--INEDLCGGVLIDPSWVITAA 62

  Fly    68 HCVKQGNNV-APANELEIQAGSLLLSSGGVRVPVATVTVHPNY------------NSNGHDVAVL 119
            ||.....:| ...|.|.......|:|..         ..||:|            ....:|:.:|
  Rat    63 HCYSDNYHVLLGQNNLSEDVQHRLVSQS---------FRHPDYKPFLMRNHTRKPKDYSNDLMLL 118

  Fly   120 RLRNSLTFNSNIAAIKLATEDPPNDATVDISGWGAIS-QRGPISNSLLYVQVKALSRESCQKTYL 183
            .|.........:..|.|.|::|...:|..:||||:.: ......:.|..|.:..||.|.|.|.|.
  Rat   119 HLSEPADITDGVKVIDLPTKEPKVGSTCLVSGWGSTNPSEWEFPDDLQCVNIHLLSNEKCIKAYK 183

  Fly   184 RQLPETTMC---LLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDG-YERVSKLRNW 244
            .::.:..:|   |...||  .|.||||||....|.|.|:.|:....||.....| |.::.|..:|
  Rat   184 EKVTDLMLCAGELEGGKD--TCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIKFTSW 246

  Fly   245 IAE 247
            |.|
  Rat   247 IKE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 65/235 (28%)
Tryp_SPc 28..248 CDD:238113 67/238 (28%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 65/235 (28%)
Tryp_SPc 25..250 CDD:238113 67/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.