DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Klk10

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:261 Identity:68/261 - (26%)
Similarity:110/261 - (42%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPFWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVT 65
            |:..|      .|..:|...::..|.....||.......|.|:||.......|.|.::.:::|:|
  Rat    26 MMQLW------AAQALLLPGNTTREDLEAFGTLCPSVSQPWQVSLFHNLQFQCAGVLVDQNWVLT 84

  Fly    66 AAHCVKQGNNVAPANELEIQAGS---LLLSSGGVRVPVATVTVHPNY----------NSNGHDVA 117
            ||||.:.       ..|..:.|.   ||..|..:|...:.| .||.|          .|:.||:.
  Rat    85 AAHCWRN-------KPLRARVGDDHLLLFQSEQLRSTNSPV-FHPKYQPCSGPVLPLRSDEHDLM 141

  Fly   118 VLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWG-AISQRGPISNSLLYVQVKALSRESCQKT 181
            :|:|.:.:...|.:..::|..:.........:|||| ..::|...:.||...:|..||::.|:..
  Rat   142 MLKLSSPVVLTSKVHPVQLPFQCAQPRQECQVSGWGTTANRRVKYNRSLSCSRVTLLSQKQCETF 206

  Fly   182 YLRQLPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAA--PDGYERVSKLRNW 244
            |...:....:|....:|:.:|..|||||......|.|:.|:.|..||.|.  |..|.::....||
  Rat   207 YPGVITNNMICAGMDRDQDSCQSDSGGPLVCDNTLHGILSWSIYPCGAATQYPAVYAKICNYTNW 271

  Fly   245 I 245
            |
  Rat   272 I 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 61/233 (26%)
Tryp_SPc 28..248 CDD:238113 63/234 (27%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 61/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.