DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss38

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:241 Identity:66/241 - (27%)
Similarity:113/241 - (46%) Gaps:33/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91
            :::||....:.::|.|:|:...|.|.|||||::..:|:|||||.        |.|..:|...:.:
  Rat   113 KLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHCF--------AREKRLQTFDMYV 169

  Fly    92 SSGGVRV--------PVATVTVHPN---YNSNGHDVAVLRLRNSLTFNSNIAAIKLATED-PPND 144
            ....:.|        .:..|.:||.   ::..|.|||:::.::::.|:..:..|.|.:.: ..:|
  Rat   170 GITNLEVANKHTQWFEINQVIIHPTFEMFHPVGGDVALVQSKSAIVFSDYVLPICLPSSNLNLSD 234

  Fly   145 ATVDISGWGAISQRGPISNSLLYVQVKALSRESCQ-----KTYLRQLPETTMCLLHPKD-KGACY 203
            .:...:|||.:|.:|.....||..|:..:.:..||     .:||  ||| .:|....|: |..|.
  Rat   235 LSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYGLTSYL--LPE-MLCAGDIKNMKNVCE 296

  Fly   204 GDSGGPATYQGKLVGLASFVIG---GCGRAA-PDGYERVSKLRNWI 245
            ||||.|...:.....|...::.   ||.:.. |..:..||...|||
  Rat   297 GDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 64/239 (27%)
Tryp_SPc 28..248 CDD:238113 66/240 (28%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 66/238 (28%)
Tryp_SPc 116..342 CDD:214473 64/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.