DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss34

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:254 Identity:75/254 - (29%)
Similarity:113/254 - (44%) Gaps:47/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGTKAREGQFPHQISLR------RRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELE--- 83
            ||||......:||.|:|||      .:..|.||||:|...:|:||||||:       ..|:|   
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVE-------LKEMEASC 90

  Fly    84 --IQAGSLLLSSGGVRVPVATVTVHPNYNS-----NGHDVAVLRLRNSLTFNSNIAAIKL--ATE 139
              :|.|.|.|......:.||.:..||.::.     .|.|:|:|:|.:::..:..:..:.|  |::
  Rat    91 FRVQVGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQ 155

  Fly   140 DPPNDATVDISGWGAISQRGPISN--SLLYVQVKALSRESCQKTY--LRQLPETTMCLLHPKD-- 198
            ...:..|..::|||.|....|:..  .|..|.|..:....|::.|  ...|..||..:   ||  
  Rat   156 RISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKII---KDDM 217

  Fly   199 -------KGACYGDSGGPATYQGKL----VGLASFVIGGCGRA-APDGYERVSKLRNWI 245
                   :.:|..|||||...:...    ||:.|:.| |||.. .|..|.||....:||
  Rat   218 LCAGMEGRDSCQADSGGPLVCRWNCSWVQVGVVSWGI-GCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 73/252 (29%)
Tryp_SPc 28..248 CDD:238113 75/254 (30%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 75/254 (30%)
Tryp_SPc 33..275 CDD:214473 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.