DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss29

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:263 Identity:86/263 - (32%)
Similarity:124/263 - (47%) Gaps:39/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AGVLAQNDSVVEPRIVGGTKAREGQFPHQISLR------RRGSHTCGGSIISKDYVVTAAHCVKQ 72
            ||:.|.....|...||||..|.:|::|.|:|||      ....|.||||||...:|:|||||:.:
  Rat    17 AGIPASVPEDVLVGIVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHE 81

  Fly    73 GNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNY--NSNGHDVAVLRLRNSLTFNSNIAAIK 135
            .:  |..:...|..|.:.|..|...:.|:.|.:||::  :..|.|||:|:|..|:....|:..:|
  Rat    82 SD--ADPSAFRIYLGQVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVK 144

  Fly   136 LATEDPPNDATVD------ISGWGAISQRG--PISNSLLYVQVKALSRESCQKTY---------- 182
            |:    |....|.      ::|||::|...  |....|..||||.:....|:|.|          
  Rat   145 LS----PASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHG 205

  Fly   183 LRQLPETTMCL-LHPKDKGACYGDSGGP----ATYQGKLVGLASFVIGGCGRAAPDGYERVSKLR 242
            .|.:.:..:|. .|.:|  :||||||||    .|....|||:.|:..|...:..|..|.||....
  Rat   206 QRLILQDMLCAGSHGRD--SCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIPGVYARVQFFL 268

  Fly   243 NWI 245
            .||
  Rat   269 PWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 80/248 (32%)
Tryp_SPc 28..248 CDD:238113 82/249 (33%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.