DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss27

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:250 Identity:78/250 - (31%)
Similarity:120/250 - (48%) Gaps:42/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91
            |:|||..|.||::|.|:|::|.|:|.||||:|:..:|:|||||.   :|.:..:..::..|:|.|
  Rat    37 RMVGGEDALEGEWPWQVSIQRNGAHFCGGSLIAPTWVLTAAHCF---SNTSDISIYQVLLGALKL 98

  Fly    92 SSGG---VRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVD--- 148
            ...|   :.|||..|..||.|.  ::..|||::.|:..:||...|..:.|     |:.:.|.   
  Rat    99 QQPGPHALYVPVKRVKSHPEYQGMASSADVALVELQVPVTFTKYILPVCL-----PDPSVVFKSG 158

  Fly   149 ----ISGWGAISQRGPISNS--LLYVQVKALSRESCQKTY---------LRQLPETTMCL-LHPK 197
                ::|||:.|::..:.|.  |..:.|..:....|...|         |:.:.:..:|. ....
  Rat   159 MNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTPKCNLLYSKDAEADIQLKTIKDDMLCAGFAEG 223

  Fly   198 DKGACYGDSGGPATYQGKLV-------GLASFVIGGCGRAAPDGYERVSKLRNWI 245
            .|.||.||||||...   ||       |:.|:..|...|..|..|.||:....||
  Rat   224 KKDACKGDSGGPLVC---LVDQSWVQAGVISWGEGCARRNRPGVYIRVASHYQWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 76/248 (31%)
Tryp_SPc 28..248 CDD:238113 76/248 (31%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 76/248 (31%)
Tryp_SPc 39..278 CDD:238113 76/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.