DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and LOC286960

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:244 Identity:77/244 - (31%)
Similarity:119/244 - (48%) Gaps:18/244 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNN 75
            |.||..|..||   :.:||||....:...|:|:||....||.||||:||..:|::||||.|:   
  Rat    10 LGAAVALPVND---DDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKR--- 68

  Fly    76 VAPANELEIQAGS---LLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAIK 135
                 :|:::.|.   .:|..|...:....:..||.||.:  .:|:.:::|::....||.::.:.
  Rat    69 -----KLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVS 128

  Fly   136 LATEDPPNDATVDISGWG-AISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCL-LHPKD 198
            |.......||...:|||| .:|..|.....|..::...||..||:|:|..|:.....|| .....
  Rat   129 LPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGG 193

  Fly   199 KGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247
            |.:|.||||||....|::.|:.|:......|..|..|.:|....:||.|
  Rat   194 KDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 68/224 (30%)
Tryp_SPc 28..248 CDD:238113 71/227 (31%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 68/224 (30%)
Tryp_SPc 24..243 CDD:238113 71/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.