DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss3b

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:247 Identity:77/247 - (31%)
Similarity:124/247 - (50%) Gaps:18/247 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQ 72
            |..|.||..|..:|.  :.:||||...::...|:|:|| ..|.|.||||:|:..:||:||||.| 
  Rat     7 LAFLGAAVALPLDDD--DDKIVGGYTCQKNSLPYQVSL-NAGYHFCGGSLINSQWVVSAAHCYK- 67

  Fly    73 GNNVAPANELEIQAG--SLLLSSGGVR-VPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIA 132
                   :.::::.|  ::.:..||.: :..|.:..||:||:|  .:|:.:::|.:..|.||.::
  Rat    68 -------SRIQVRLGEHNIDVVEGGEQFIDAAKIIRHPSYNANTFDNDIMLIKLNSPATLNSRVS 125

  Fly   133 AIKLATEDPPNDATVDISGWGAISQRGPISNSLLY-VQVKALSRESCQKTYLRQLPETTMCL-LH 195
            .:.|......:.....:||||.....|....|||. :....||..||:.:|..::.....|| ..
  Rat   126 TVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSSYPGKITSNMFCLGFL 190

  Fly   196 PKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247
            ...|.:|.||||||....|:|.|:.|:..|...:..|..|.:|....|||.:
  Rat   191 EGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTKVCNYVNWIQQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/224 (31%)
Tryp_SPc 28..248 CDD:238113 71/227 (31%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 69/224 (31%)
Tryp_SPc 25..243 CDD:238113 71/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.