DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and KLK9

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:251 Identity:68/251 - (27%)
Similarity:103/251 - (41%) Gaps:22/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGN 74
            :|||...|.......:.|.:|..:.|....|.|..|.......||.::||..:::|||||.|   
Human     5 LLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHCRK--- 66

  Fly    75 NVAPANELEIQAGSLLLSSGGVRV-PVATVTVHPNYN----SNGH--DVAVLRLRNSLTFNSNIA 132
               |...:.:....|....|..:: .|.....||.:|    :|.|  |:.::||......:..:.
Human    67 ---PYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQ 128

  Fly   133 AIKLATEDPPNDATVDISGWGAISQ-RGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCL-LH 195
            .:.|:...........||||||:|. :.....:|....:..|..:.|...|...:.::.:|. |.
Human   129 PLNLSQTCVSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYPGHISDSMLCAGLW 193

  Fly   196 PKDKGACYGDSGGPATYQGKLVGLASFVIGG---CGR-AAPDGYERVSKLRNWIAE 247
            ...:|:|.||||||....|.|.|:.|   ||   |.| ..|..|..|....:||.|
Human   194 EGGRGSCQGDSGGPLVCNGTLAGVVS---GGAEPCSRPRRPAVYTSVCHYLDWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 61/230 (27%)
Tryp_SPc 28..248 CDD:238113 63/233 (27%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.