DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG33225

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:238 Identity:53/238 - (22%)
Similarity:98/238 - (41%) Gaps:23/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91
            |:|||..|.....|..:.:....:..|.||:|::.:|:|:|.|:..........|.:....|...
  Fly    56 RVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLSLPKQVILGEYDRNCTSADC 120

  Fly    92 SSGGVRVPVATVTVHPNY---NSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDAT--VDISG 151
            :|....:.:....:|..:   ....:|:|:|||...::.:..:..|.|:.:.....:.  ...:|
  Fly   121 TSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATG 185

  Fly   152 WGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGACYGDSGGPATY---- 212
            ||......| |..|..|.:..::|:.|:....:.:..:.:|:..|: |..|.||:|||.:.    
  Fly   186 WGTTEWNEP-STILQTVTLSKINRKYCKGRLRQNIDASQLCVGGPR-KDTCSGDAGGPLSLTLKI 248

  Fly   213 --QGK--------LVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
              .||        |:|:.|:....|.....  |..|....:||
  Fly   249 DGDGKWNNKSRAFLIGIVSYGSSSCSGIGV--YTNVEHYMDWI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 51/236 (22%)
Tryp_SPc 28..248 CDD:238113 52/237 (22%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 51/236 (22%)
Tryp_SPc 57..292 CDD:238113 52/237 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.