DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG33459

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:250 Identity:70/250 - (28%)
Similarity:100/250 - (40%) Gaps:45/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG---- 87
            ||.||..|.....|....|.......||||:|:.::|:||||||..    .|.| |.::.|    
  Fly    37 RIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMP----TPKN-LTVRLGEYDW 96

  Fly    88 -----SLLLSSGGVRVPVATVTVHPNYNS-NGHDVAVLRLRNSLTFNSNIAAIKLATEDPPN--- 143
                 |:..........|..:..||:|.| ..:|:|:|:|..::.:...|..|.|..  |.|   
  Fly    97 TRQMDSINPKHRHREYMVTRIYTHPSYRSIAAYDIALLKLNQTVEYTVAIRPICLVL--PENFHE 159

  Fly   144 -----DATVD--ISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGA 201
                 |:..|  ::|||| ::..|:|..|....:..:.|.:|...|...:..|.:|....| ..|
  Fly   160 WYWLVDSVEDFTLTGWGA-TKTEPVSQVLQSANLTQIDRGTCHDRYGHSVDHTHICAGSSK-SFA 222

  Fly   202 CYGDSGGPAT--------YQGKLVGLASFVIGGCGRAAPDG---YERVSKLRNWI 245
            |.||||.|..        |....||:.|.....|     ||   :..|.....||
  Fly   223 CVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNC-----DGVTVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 68/248 (27%)
Tryp_SPc 28..248 CDD:238113 68/248 (27%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 68/248 (27%)
Tryp_SPc 38..272 CDD:238113 67/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.