DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CG33458

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:242 Identity:64/242 - (26%)
Similarity:101/242 - (41%) Gaps:48/242 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPFWTSLLVLCAAGV------LAQNDSVVEP---RIVGGTKAREGQFPHQISLRRRGSHTCGGS 56
            ::|...:||:| ..|:      |.:.|..:..   ||.||..:.....|....|.......||||
  Fly     3 LIPALLALLIL-GHGISLGYSYLLEWDCGISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGS 66

  Fly    57 IISKDYVVTAAHC---------VKQGNNVA----PANELEIQAGSLLLSSGGVRVPVATVTVHPN 108
            :::..:|:|||||         |:.|.|.|    ..||.|..|..|       ...:....:||.
  Fly    67 LLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHL-------EYMIMQKLIHPL 124

  Fly   109 Y-NSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPN-DATVD------ISGWGAISQRGPISNSL 165
            | .::.:|:|:.:|...:.:..:|..|.|...  || ...||      |:|||| :....:|:.|
  Fly   125 YRTAHYYDIALAKLNRYVVYTDSIRPICLMLN--PNWQVYVDTIRYFIITGWGA-TNASEVSDKL 186

  Fly   166 LYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGACY---GDSGGP 209
            ...::..:.|.:|:..:...:..|.:|....|.    |   ||||||
  Fly   187 QLTRIPQIDRFTCRYWFGYMVDRTHICAGESKH----YVGKGDSGGP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 57/207 (28%)
Tryp_SPc 28..248 CDD:238113 56/206 (27%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 57/207 (28%)
Tryp_SPc 38..274 CDD:238113 56/206 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.